PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do005362.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family Nin-like
Protein Properties Length: 924aa    MW: 102301 Da    PI: 6.4263
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do005362.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK85.54.6e-27581631252
      RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 ek+ sle++++yF +++k+AAk+Lgvc+T++KriCRq+GI+RWP+R+i+++
  Do005362.1 581 EKTFSLEVIQHYFTGSLKNAAKSLGVCPTTMKRICRQHGISRWPSRQISKV 631
                 8999********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.961570651IPR003035RWP-RK domain
PfamPF020422.2E-23584631IPR003035RWP-RK domain
SuperFamilySSF542771.57E-22820915No hitNo description
SMARTSM006663.6E-25830912IPR000270PB1 domain
PROSITE profilePS5174518.825830912IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2408.4E-25831911No hitNo description
PfamPF005648.5E-17831911IPR000270PB1 domain
CDDcd064073.35E-32831911No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 924 aa     Download sequence    Send to blast
MEFDFDSPNG GDAWLLDAMA TSPHFSAASP PLPLPLPWPC GDPHHHPSLA LDMAALQDDD  60
APGARAGEVF SDSTIDFAVP FFTTPCGKSE ITKKGEPVNG KCQVHLSMVD DYSDSSYFLK  120
ERLTLALRHF KGSTNQHLLV QVWVPIKKGD RYMLSTSGQP FVLDQRSIGL LQYRAVSMMY  180
IFSVDGDCVK ELGLPGRVYK QRVPEWTPSV QYYSSTEYAR LNHAISYNIH GTIALPVFDP  240
STKSCIAVVE LIMTSKKVNY ASEVGKICKA LEAVNLKSTE VVEHPYVQIR NEGHQAALVE  300
MLEILTVIGE ELKLPLAQTW VPCKYQNLLV HCGGVKKSRF NIHESCAQEL CMSTSDVAFH  360
VIDAHMWGFR DACVEHHLQK EQGVSGKAFI LRRPCFSKDV TRFSKMEYPI VHYARMFGLA  420
GCFSVCLQSA YTGSDDYVLE FFLPPDCRED GEQKVLLESI LALLRQHLHS LHVATDEASN  480
EELQVDAITV IDNYEMKGAY VQHLNFEGGF PASYESNTHG IHESDSQKRI ASIEYEMCLS  540
PENNTKCNGK LFDGPNGGCT SDSLLPDNNS KHHGRRRGKA EKTFSLEVIQ HYFTGSLKNA  600
AKSLGVCPTT MKRICRQHGI SRWPSRQISK VNRSISKLKK VIESVEGSES AFTLTSITGP  660
LPVPFSPSNP INIKNGRQTK VTDLSIPSVQ ENRGSLSQSK LLENDDHLGM LIPQQSFLAN  720
ISRQIEREKA SNLRSSSGEP STHSGTSEDS CLGSPANRTF VSTLVEPQQN MCQPDSFTKE  780
PFQTQDLLLP GQFFNSSGSS KNFKNNITAA GNEPSVVPLG SLMSVQNSGI VTVKARYKED  840
LLRFRFPCSA SIIDLKDEVA KRILIDVGVF DIKYLDDDHE WVKLTCDADL EECMEISRLS  900
GSNVLRLLVT DIAPILGSSC GSTG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960682.10.0PREDICTED: protein NLP3-like isoform X1
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLK3Z3P20.0K3Z3P2_SETIT; Uncharacterized protein
STRINGSi021160m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein